Skip to main content

New Drug Approvals 2014 - Pt. V - Metreleptin (MyaleptTM)



ATC Code (s): A08A, A10X, A16A
Wikipedia: Metreleptin

On February 24th 2014, the FDA approved metreleptin (Tradename: Myalept), a leptin analogue, as an adjunct to diet and replacement therapy, for the treatment of complications associated with leptin deficiency in patients with congenital or acquired generalized lipodystrophy.

Lipodystrophy is a rare condition characterized by abnormalities in adipose (fat) tissue distribution. It can be congenital, i.e. the patient is born with little or no adipose tissue, or it can be acquired, for example, after prolonged antiretroviral drug therapy some patients keep on losing adipose tissue with time. The deficiency of adipose tissue leads to hypertriglyceridemia and ectopic deposition of fat in non-adipose tissues such as liver and muscle, contributing to metabolic abnormalities including insulin resistance.

Leptin is an endogenous hormone, predominantly secreted in the adipose tissue, responsible to signal to the central nervous system, the status of energy stores in the body. In patients with lipodystrophy, the levels of this hormone are lower, resulting in excess caloric intake, which exacerbates the metabolic abnormalities.

Metreleptin is a recombinant human leptin analogue, which exert its function by binding to and activating the human leptin receptor. This increases insulin sensitivity and reduces food intake, soothing the metabolic abnormalities of patients with lipodystrophy.

Leptin receptor (Uniprot accession: P48357; ChEMBL ID: CHEMBL5913) is a member of the cytokine family class I, which signals through the JAK/STAT transduction pathway. Currently, there is one crystal structure of the human leptin receptor in complex with an antibody (PDBe: 3v6o). The structure is shown bellow, and the leptin receptor is depicted in green.


The -leptin USAN/INN stem covers leptin derivatives. Metreleptin is the first approved drug of its class, and the only member so far. In Japan, metreleptin was approved on May 25 th 2013 for the treatment of metabolic disorders, including lipodystrophy (see PMID: 23740412).

Metreleptin (ChEMBL: CHEMBL2107857) is a recombinant human leptin analog produced in E. coli and differs from native human leptin by the addition of a methionine residue at its amino terminus. Metreleptin is a 147-amino acid, nonglycosylated, polypeptide with one disulfide bond between Cys-97 and Cys-147 and a molecular weight of approximately 16.15 kDa.

>Metreleptin
MVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLA
VYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGY
STEVVALSRLQGSLQDMLWQLDLSPGC

Metreleptin is available as a lyophilized cake, which is later reconstituted with bacteriostatic or preservative-free sterile water, for subcutaneous injection. The recommended starting daily dose is 0.06 mg/kg in patients weighting less than 40 kg, 2.5 mg in male patients weighting more than 40Kg, and 5 mg in female patients weighting more than 40 kg, with a respective maximum daily dose of 0.13 mg/kg, 10 mg and 10 mg. In healthy subjects, the peak serum concentration (Cmax) of leptin is reached at 4.0 to 4.3 hours after subcutaneous administration of single doses ranging from 0.1 to 0.3 mg/kg, and following intravenous administration of metreleptin, leptin volume of distribution is 370 ± 184 mL/kg for a dose of 0.3 mg/kg/day. Metreleptin bioavailability is not influence by food intake, hence it can be administered without regard to the timing of meals.

No formal metabolism studies have been conducted with metreleptin, however, nonclinical data indicates renal clearance is the major route of metreleptin elimination, with no apparent contribution of systemic metabolism or degradation. In healthy subjects, following single subcutaneous doses of 0.01 to 0.3 mg/mL, the half-life t1/2 of metreleptin is 3.8 to 4.7 hours.

Metreleptin has been approved with a black box warning due to the risks associated with the development of antimetreleptin antibodies that neutralize endogenous leptin and/or metreleptin and the risk for T-cell lymphoma. Consequently, metreleptin is only available through the Myalept Risk Evaluation and Mitigation Strategy (REMS) Program.

The license holder for MyaleptTM is Amylin Pharmaceuticals, a subsidiary of Bristol-Myers Squibb, and the full prescribing information can be found here.

Comments

Popular posts from this blog

A python client for accessing ChEMBL web services

Motivation The CheMBL Web Services provide simple reliable programmatic access to the data stored in ChEMBL database. RESTful API approaches are quite easy to master in most languages but still require writing a few lines of code. Additionally, it can be a challenging task to write a nontrivial application using REST without any examples. These factors were the motivation for us to write a small client library for accessing web services from Python. Why Python? We choose this language because Python has become extremely popular (and still growing in use) in scientific applications; there are several Open Source chemical toolkits available in this language, and so the wealth of ChEMBL resources and functionality of those toolkits can be easily combined. Moreover, Python is a very web-friendly language and we wanted to show how easy complex resource acquisition can be expressed in Python. Reinventing the wheel? There are already some libraries providing access to ChEMBL d

ChEMBL 29 Released

  We are pleased to announce the release of ChEMBL 29. This version of the database, prepared on 01/07/2021 contains: 2,703,543 compound records 2,105,464 compounds (of which 2,084,724 have mol files) 18,635,916 activities 1,383,553 assays 14,554 targets 81,544 documents Data can be downloaded from the ChEMBL FTP site:   https://ftp.ebi.ac.uk/pub/databases/chembl/ChEMBLdb/releases/chembl_29 .  Please see ChEMBL_29 release notes for full details of all changes in this release: https://ftp.ebi.ac.uk/pub/databases/chembl/ChEMBLdb/releases/chembl_29/chembl_29_release_notes.txt New Deposited Datasets EUbOPEN Chemogenomic Library (src_id = 55, ChEMBL Document IDs CHEMBL4649982-CHEMBL4649998): The EUbOPEN consortium is an Innovative Medicines Initiative (IMI) funded project to enable and unlock biology in the open. The aims of the project are to assemble an open access chemogenomic library comprising about 5,000 well annotated compounds covering roughly 1,000 different proteins, to synthesiz

Identifying relevant compounds in patents

  As you may know, patents can be inherently noisy documents which can make it challenging to extract drug discovery information from them, such as the key targets or compounds being claimed. There are many reasons for this, ranging from deliberate obfuscation through to the long and detailed nature of the documents. For example, a typical small molecule patent may contain extensive background information relating to the target biology and disease area, chemical synthesis information, biological assay protocols and pharmacological measurements (which may refer to endogenous substances, existing therapies, reaction intermediates, reagents and reference compounds), in addition to description of the claimed compounds themselves.  The SureChEMBL system extracts this chemical information from patent documents through recognition of chemical names, conversion of images and extraction of attached files, and allows patents to be searched for chemical structures of interest. However, the curren

Julia meets RDKit

Julia is a young programming language that is getting some traction in the scientific community. It is a dynamically typed, memory safe and high performance JIT compiled language that was designed to replace languages such as Matlab, R and Python. We've been keeping an an eye on it for a while but we were missing something... yes, RDKit! Fortunately, Greg very recently added the MinimalLib CFFI interface to the RDKit repertoire. This is nothing else than a C API that makes it very easy to call RDKit from almost any programming language. More information about the MinimalLib is available directly from the source . The existence of this MinimalLib CFFI interface meant that we no longer had an excuse to not give it a go! First, we added a BinaryBuilder recipe for building RDKit's MinimalLib into Julia's Yggdrasil repository (thanks Mosè for reviewing!). The recipe builds and automatically uploads the library to Julia's general package registry. The build currently targe

New Drug Warnings Browser

As mentioned in the announcement post of  ChEMBL 29 , a new Drug Warnings Browser has been created. This is an updated version of the entity browsers in ChEMBL ( Compounds , Targets , Activities , etc). It contains new features that will be tried out with the Drug Warnings and will be applied to the other entities gradually. The new features of the Drug Warnings Browser are described below. More visible buttons to link to other entities This functionality is already available in the old entity browsers, but the button to use it is not easily recognised. In the new version, the buttons are more visible. By using those buttons, users can see the related activities, compounds, drugs, mechanisms of action and drug indications to the drug warnings selected. The page will take users to the corresponding entity browser with the items related to the ones selected, or to all the items in the dataset if the user didn’t select any. Additionally, the process of creating the join query is no