Skip to main content

New Drug Approvals 2013 - Pt. 1 - Alogliptin (NesinaTM)


ATC Code: A10BH04
Wikipedia: Alogliptin

On January 25th 2013, FDA approved Alogliptin (as the benzoate salt; tradename: Nesina; research code: SYR-322, TAK-322; CHEMBL: CHEMBL376359), a dipeptidyl peptidase-4 (DPP-4) inhibitor indicated as an adjunct to diet and exercise to improve glycemic control in adults with type 2 diabetes mellitus (also known as noninsulin-dependent diabetes mellitus (NIDDM)).

NIDDM is a chronic disease characterized by high blood glucose. In response to meals, increased concentrations of incretin hormones such as glucagon-like peptide-1 (GLP-1) and glucose-dependent insulinotropic polypeptide (GIP) are released into the bloodstream from the small intestine. These hormones cause insulin release from the pancreatic beta cells in a glucose-dependent manner but are inactivated by the DPP-4 enzyme within minutes. GLP-1 also lowers glucagon secretion from pancreatic alpha cells, reducing hepatic glucose production. In patients with NIDDM, concentrations of GLP-1 are reduced but the insulin response to GLP-1 is preserved. Alogliptin exerts its therapeutic action by inhibiting DPP-4, thereby slowing the inactivation of the incretin hormones and increasing their bloodstream concentrations.

Image from Wikipedia

Other DPP-4 inhibitors are already available on the market (some of which have already been covered here on the ChEMBL-og) and these include Linagliptin (approved in 2011 under the tradename Tradjenta; ChEMBL: CHEMBL237500; PubChem: CID10096344; ChemSpider: 8271879), Saxagliptin (approved in 2009 under the tradename Onglyza; ChEMBL: CHEMBL385517; PubChem: CID11243969; ChemSpider: 9419005) and Sitagliptin (approved in 2006 under the tradename Januvia; ChEMBL: CHEMBL1422; PubChem: CID4369359; ChemSpider: 3571948). Several other DPP-4 inhibitors are in clinical trials such as Trelagliptin (ChEMBL: CHEMBL1650443; research code: SYR-472), Omarigliptin (ChEMBL: CHEMBL2105762; research code: MK-3102), Carmegliptin (ChEMBL: CHEMBL591118; research code: R-1579, RO-4876904), Gosogliptin (ChEMBL: CHEMBL515387; research code: PF-734200), Dutogliptin (research code: PHX1149), Denagliptin (ChEMBL: CHEMBL2110666; research code: GW823093). Vildagliptin (ChEMBL: CHEMBL142703) has been approved in Europe and Japan, but not in the United States.

DPP-4 (ChEMBL: CHEMBL284; Uniprot: P27487) is 766 amino acid-long enzyme, which is responsible for the removal of N-terminal dipeptides sequentially from polypeptides having unsubstituted N termini, provided that the penultimate residue is proline. It belongs to the Dipeptidyl peptidase IV family (PFAM: PF00930).

>DPP4_HUMAN Dipeptidyl peptidase 4
MKTPWKVLLGLLGAAALVTIITVPVVLLNKGTDDATADSRKTYTLTDYLKNTYRLKLYSL
RWISDHEYLYKQENNILVFNAEYGNSSVFLENSTFDEFGHSINDYSISPDGQFILLEYNY
VKQWRHSYTASYDIYDLNKRQLITEERIPNNTQWVTWSPVGHKLAYVWNNDIYVKIEPNL
PSYRITWTGKEDIIYNGITDWVYEEEVFSAYSALWWSPNGTFLAYAQFNDTEVPLIEYSF
YSDESLQYPKTVRVPYPKAGAVNPTVKFFVVNTDSLSSVTNATSIQITAPASMLIGDHYL
CDVTWATQERISLQWLRRIQNYSVMDICDYDESSGRWNCLVARQHIEMSTTGWVGRFRPS
EPHFTLDGNSFYKIISNEEGYRHICYFQIDKKDCTFITKGTWEVIGIEALTSDYLYYISN
EYKGMPGGRNLYKIQLSDYTKVTCLSCELNPERCQYYSVSFSKEAKYYQLRCSGPGLPLY
TLHSSVNDKGLRVLEDNSALDKMLQNVQMPSKKLDFIILNETKFWYQMILPPHFDKSKKY
PLLLDVYAGPCSQKADTVFRLNWATYLASTENIIVASFDGRGSGYQGDKIMHAINRRLGT
FEVEDQIEAARQFSKMGFVDNKRIAIWGWSYGGYVTSMVLGSGSGVFKCGIAVAPVSRWE
YYDSVYTERYMGLPTPEDNLDHYRNSTVMSRAENFKQVEYLLIHGTADDNVHFQQSAQIS
KALVDVGVDFQAMWYTDEDHGIASSTAHQHIYTHMSHFIKQCFSLP

The image above shows a crystal structure of DPP-4 (in this example, two copies of DPP-4 are displayed - PDBe: 3g0b). Information on the active site of DPP-4 can be found here.


Alogliptin is an oral small-molecule with a molecular weight of 339.4 Da (461.51 Da as the benzoate salt). The image on the right shows Alogliptin in the active site of DPP-4. Important features of its chemical structure are the aminopiperidine motif, which provides a salt bridge to the glutamic acids residues 205/206 in the active site of DPP-4, the cyanobenzyl group which interacts with the arginine residue 125, the carbonyl group from the pyrimidinedione moiety which participates in an hydrogen bond with the backbone NH of tyrosine 631 and the uracil ring which π-stacks with tyrosine 547.
IUPAC: 2-[[6-[(3R)-3-aminopiperidin-1-yl]-3-methyl-2,4-dioxopyrimidin-1-yl]methyl]benzonitrile
Canonical Smiles: CN1C(=O)C=C(N2CCC[C@@H](N)C2)N(Cc3ccccc3C#N)C1=O
InChI: InChI=1S/C18H21N5O2/c1-21-17(24)9-16(22-8-4-7-15(20)12-22)23(18(21)25)11-14-6-3-2-5-13(14)10-19/h2-3,5-6,9,15H,4,7-8,11-12,20H2,1H3/t15-/m1/s1

The recommended dosage of Alogliptin is 25 mg once daily. Alogliptin has good oral bioavailability F (approximately 100% bioavailable), with a volume of distribution Vd of 417 L and a low plasma protein binding (20%). Excretion is mainly renal (76% of the dose recovered in urine) and mostly as the parent compound (60% to 71%). Alogliptin is metabolized by CYP2D6 and CYP3A4 to two minor metabolites, M-I (N-demethylated alogliptin - &gt1% of the parent drug), which is an active metabolite and is an inhibitor of DPP-4 similar to the parent molecule and M-II (N-acethylated alogliptin - &gt6% of the parent drug), which does not display any inhibitory activity towards DPP-4 or other DPP-related enzymes. The renal clearance of Alogliptin is 9.6 L/hr and the systemic clearance is 14.0 L/hr.

The license holder is Takeda Pharmaceuticals America, Inc. and the prescribing information of Alogliptin can be found here.

Patricia

Comments

Popular posts from this blog

A python client for accessing ChEMBL web services

Motivation The CheMBL Web Services provide simple reliable programmatic access to the data stored in ChEMBL database. RESTful API approaches are quite easy to master in most languages but still require writing a few lines of code. Additionally, it can be a challenging task to write a nontrivial application using REST without any examples. These factors were the motivation for us to write a small client library for accessing web services from Python. Why Python? We choose this language because Python has become extremely popular (and still growing in use) in scientific applications; there are several Open Source chemical toolkits available in this language, and so the wealth of ChEMBL resources and functionality of those toolkits can be easily combined. Moreover, Python is a very web-friendly language and we wanted to show how easy complex resource acquisition can be expressed in Python. Reinventing the wheel? There are already some libraries providing access to ChEMBL d

ChEMBL 29 Released

  We are pleased to announce the release of ChEMBL 29. This version of the database, prepared on 01/07/2021 contains: 2,703,543 compound records 2,105,464 compounds (of which 2,084,724 have mol files) 18,635,916 activities 1,383,553 assays 14,554 targets 81,544 documents Data can be downloaded from the ChEMBL FTP site:   https://ftp.ebi.ac.uk/pub/databases/chembl/ChEMBLdb/releases/chembl_29 .  Please see ChEMBL_29 release notes for full details of all changes in this release: https://ftp.ebi.ac.uk/pub/databases/chembl/ChEMBLdb/releases/chembl_29/chembl_29_release_notes.txt New Deposited Datasets EUbOPEN Chemogenomic Library (src_id = 55, ChEMBL Document IDs CHEMBL4649982-CHEMBL4649998): The EUbOPEN consortium is an Innovative Medicines Initiative (IMI) funded project to enable and unlock biology in the open. The aims of the project are to assemble an open access chemogenomic library comprising about 5,000 well annotated compounds covering roughly 1,000 different proteins, to synthesiz

Julia meets RDKit

Julia is a young programming language that is getting some traction in the scientific community. It is a dynamically typed, memory safe and high performance JIT compiled language that was designed to replace languages such as Matlab, R and Python. We've been keeping an an eye on it for a while but we were missing something... yes, RDKit! Fortunately, Greg very recently added the MinimalLib CFFI interface to the RDKit repertoire. This is nothing else than a C API that makes it very easy to call RDKit from almost any programming language. More information about the MinimalLib is available directly from the source . The existence of this MinimalLib CFFI interface meant that we no longer had an excuse to not give it a go! First, we added a BinaryBuilder recipe for building RDKit's MinimalLib into Julia's Yggdrasil repository (thanks Mosè for reviewing!). The recipe builds and automatically uploads the library to Julia's general package registry. The build currently targe

Identifying relevant compounds in patents

  As you may know, patents can be inherently noisy documents which can make it challenging to extract drug discovery information from them, such as the key targets or compounds being claimed. There are many reasons for this, ranging from deliberate obfuscation through to the long and detailed nature of the documents. For example, a typical small molecule patent may contain extensive background information relating to the target biology and disease area, chemical synthesis information, biological assay protocols and pharmacological measurements (which may refer to endogenous substances, existing therapies, reaction intermediates, reagents and reference compounds), in addition to description of the claimed compounds themselves.  The SureChEMBL system extracts this chemical information from patent documents through recognition of chemical names, conversion of images and extraction of attached files, and allows patents to be searched for chemical structures of interest. However, the curren

New Drug Warnings Browser

As mentioned in the announcement post of  ChEMBL 29 , a new Drug Warnings Browser has been created. This is an updated version of the entity browsers in ChEMBL ( Compounds , Targets , Activities , etc). It contains new features that will be tried out with the Drug Warnings and will be applied to the other entities gradually. The new features of the Drug Warnings Browser are described below. More visible buttons to link to other entities This functionality is already available in the old entity browsers, but the button to use it is not easily recognised. In the new version, the buttons are more visible. By using those buttons, users can see the related activities, compounds, drugs, mechanisms of action and drug indications to the drug warnings selected. The page will take users to the corresponding entity browser with the items related to the ones selected, or to all the items in the dataset if the user didn’t select any. Additionally, the process of creating the join query is no