Skip to main content

New Drug Approvals 2012 - Pt. XXXII - Bedaquiline (SirturoTM)


ATC Code: J04AK05
Wikipedia: Bedaquiline

On December 28, the FDA approved Bedaquiline (as the fumarate salt; tradename: Sirturo; Research Code: R-403323 (for Bedaquiline Fumarate), R-207910 and TMC-207 (for Bedaquiline)), a novel, first-in-class diarylquinoline antimycobacterial drug indicated for the treatment of pulmonary multi-drug resistant tuberculosis (MDR-TB) as part of combination therapy in adults.

Turbeculosis is an infectious disease caused by the mycobacteria Mycobacterium tuberculosis, which usually affects the lungs. MDR-TB occurs when M. tuberculosis becomes resistant to the two most powerful first-line treatment anti-TB drugs, Isoniazid (ChEMBL: CHEMBL64) and Rifampin (ChEMBL: CHEMBL374478). Bedaquiline is the first anti-TB drug that works by inhibiting mycobacterial adenosine 5'-triphosphate (ATP) synthase (for Uniprot_IDs, clique here), an enzyme essential for the replication of the mycobacteria.


ATP is the most commonly used energy currency of cells for most organisms. ATP synthase produces ATP from adenosine phosphate (ADP) and inorganic phosphate using energy from a transmembrane proton-motive force generated by respiration. The image above depicts a model of the mycobacterial ATP synthase. ATP synthase has two major structural domains, F0 and F1, that act as a biological rotary motor. The F1 domain is composed of subunits α3 (Uniprot: P63673), β3 (Uniprot: P63677), γ3 (Uniprot: P63671), δ and ε (Uniprot: P63662); the F0 domain includes one a subunit (Uniprot: P63654), two b subunits (Uniprot: P63656) and 9 to 12 c subunits (Uniprot: P63691) arranged in a symmetrical disk. The F0 and F1 domains are linked by central stalks (subunits γ and ε) and peripheral stalks (subunits b and δ). The proton-motive force fuels the rotation of the transmembrane disk and the central stalk, which in turn modulates the nucleotide affinity in the catalytic β subunit, leading to the production of ATP.

It has been shown that mutation in the atpE gene, which encodes the c subunit, of the mycobacterial ATP synthase, confers resistant to Bedaquiline, suggesting that Bedaquiline binds crucially to this target (although almost certainly other components of the complex are required for a competent binding site), inhibiting the proton pump of M. tuberculosis and therefore interfering with the rotation properties of the transmembrane disk, leading to ATP depletion.
>ATPL_MYCTU ATP synthase subunit c
MDPTIAAGALIGGGLIMAGGAIGAGIGDGVAGNALISGVARQPEAQGRLFTPFFITVGLV
EAAYFINLAFMALFVFATPVK
Another notable feature is the high specificity of Bedaquiline for mycobacteria. This is due to the fact that there is very limited sequence similarity between the mycobacterial and human atpE proteins.


Bedaquiline is a diarylquinoline antimycobacterial drug, which displays both planar hydrophobic moieties and hydrogen-bonding acceptor and donor groups. It has a molecular weight of 555.50 Da (671.58 for the fumarate salt), an ALogP of 6.93, 4 hydrogen-bond acceptors and 1 hydrogen-bond donor, and therefore not fully rule-of-five compliant.

Name: (1R, 2S)-1-(6-bromo-2­ methoxy-3-quinolinyl)-4-(dimethylamino)-2-(1-naphthalenyl)-1-phenyl-2-butanol
Canonical Smiles: COc1nc2ccc(Br)cc2cc1[C@@H](c3ccccc3)[C@@](O)(CCN(C)C)c4cccc5ccccc45
InChI: InChI=1S/C32H31BrN2O2/c1-35(2)19-18-32(36,28-15-9-13-22-10-7-8-14-26(22)28)30(23-11-5-4-6-12-23)27-21-24-20-25(33)16-17-29(24)34-31(27)37-3/h4-17,20-21,30,36H,18-19H2,1-3H3/t30-,32-/m1/s1

The recommended dosage of Bedaquiline is 400 mg once daily for 2 weeks followed by 200 mg 3 times per week for 22 weeks with food.

Bedaquiline shows a volume of distribution of approximately 164 L and a plasma binding protein of > 99.9%. Bedaquiline is primarily subjected to oxidative metabolism by CYP3A4 leading to the formation of the N-monodesmethyl metabolite (M2), which is 4 to 6 times less active in terms of antimycobacterial potency. It is mainly eliminated in feces and the mean terminal half-life T1/2 of Bedaquiline and M2 is approximately 5.5 months.

The license holder is Janssen Therapeutics and the full prescribing information of Bedaquiline can be found here.

Patricia

Comments

Popular posts from this blog

UniChem 2.0

UniChem new beta interface and web services We are excited to announce that our UniChem beta site will become the default one on the 11th of May. The new system will allow us to better maintain UniChem and to bring new functionality in a more sustainable way. The current interface and web services will still be reachable for a period of time at https://www.ebi.ac.uk/unichem/legacy . In addition to it, the most popular legacy REST endpoints will also remain implemented in the new web services: https://www.ebi.ac.uk/unichem/api/docs#/Legacy Some downtime is expected during the swap.  What's new? UniChem’s current API and web application is implemented with a framework version that’s not maintained and the cost of updating it surpasses the cost of rebuilding it. In order to improve stability, security, and support the implementation and fast delivery of new features, we have decided to revamp our user-facing systems using the latest version of widely used and maintained frameworks, i

A python client for accessing ChEMBL web services

Motivation The CheMBL Web Services provide simple reliable programmatic access to the data stored in ChEMBL database. RESTful API approaches are quite easy to master in most languages but still require writing a few lines of code. Additionally, it can be a challenging task to write a nontrivial application using REST without any examples. These factors were the motivation for us to write a small client library for accessing web services from Python. Why Python? We choose this language because Python has become extremely popular (and still growing in use) in scientific applications; there are several Open Source chemical toolkits available in this language, and so the wealth of ChEMBL resources and functionality of those toolkits can be easily combined. Moreover, Python is a very web-friendly language and we wanted to show how easy complex resource acquisition can be expressed in Python. Reinventing the wheel? There are already some libraries providing access to ChEMBL d

LSH-based similarity search in MongoDB is faster than postgres cartridge.

TL;DR: In his excellent blog post , Matt Swain described the implementation of compound similarity searches in MongoDB . Unfortunately, Matt's approach had suboptimal ( polynomial ) time complexity with respect to decreasing similarity thresholds, which renders unsuitable for production environments. In this article, we improve on the method by enhancing it with Locality Sensitive Hashing algorithm, which significantly reduces query time and outperforms RDKit PostgreSQL cartridge . myChEMBL 21 - NoSQL edition    Given that NoSQL technologies applied to computational chemistry and cheminformatics are gaining traction and popularity, we decided to include a taster in future myChEMBL releases. Two especially appealing technologies are Neo4j and MongoDB . The former is a graph database and the latter is a BSON document storage. We would like to provide IPython notebook -based tutorials explaining how to use this software to deal with common cheminformatics p

ChEMBL 30 released

  We are pleased to announce the release of ChEMBL 30. This version of the database, prepared on 22/02/2022 contains: 2,786,911 compound records 2,157,379 compounds (of which 2,136,187 have mol files) 19,286,751 activities 1,458,215 assays 14,855 targets 84,092 documents Data can be downloaded from the ChEMBL FTP site: https://ftp.ebi.ac.uk/pub/databases/chembl/ChEMBLdb/releases/chembl_30/ Please see ChEMBL_30 release notes for full details of all changes in this release:  https://ftp.ebi.ac.uk/pub/databases/chembl/ChEMBLdb/releases/chembl_30/chembl_30_release_notes.txt New Deposited Datasets EUbOPEN Chemogenomic Library (src_id = 55, ChEMBL Document ID CHEMBL4689842):   The EUbOPEN consortium is an Innovative Medicines Initiative (IMI) funded project to enable and unlock biology in the open. The aims of the project are to assemble an open access chemogenomic library comprising about 5,000 well annotated compounds covering roughly 1,000 different proteins, to synthesize at least

Multi-task neural network on ChEMBL with PyTorch 1.0 and RDKit

  Update: KNIME protocol with the model available thanks to Greg Landrum. Update: New code to train the model and ONNX exported trained models available in github . The use and application of multi-task neural networks is growing rapidly in cheminformatics and drug discovery. Examples can be found in the following publications: - Deep Learning as an Opportunity in VirtualScreening - Massively Multitask Networks for Drug Discovery - Beyond the hype: deep neural networks outperform established methods using a ChEMBL bioactivity benchmark set But what is a multi-task neural network? In short, it's a kind of neural network architecture that can optimise multiple classification/regression problems at the same time while taking advantage of their shared description. This blogpost gives a great overview of their architecture. All networks in references above implement the hard parameter sharing approach. So, having a set of activities relating targets and molecules we can tra